PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca14511.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family LBD
Protein Properties Length: 184aa    MW: 20471 Da    PI: 6.8581
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca14511.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.94.8e-4581071100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la++++
  Dca14511.1   8 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKIFGASNVSKMLQELPVHQRGDAVSSLVYEANARMRDPVYGCVGAISFLQNQVSQLQMQLAVAQT 106
                 7**********************************************************************************************9998 PP

      DUF260 100 e 100
                 e
  Dca14511.1 107 E 107
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7577108IPR004883Lateral organ boundaries, LOB
PfamPF031957.9E-448105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MGGNGTSPCA SCKLLRRRCA KDCIFAPYFP SDDPHKFAIV HKIFGASNVS KMLQELPVHQ  60
RGDAVSSLVY EANARMRDPV YGCVGAISFL QNQVSQLQMQ LAVAQTEILC IQMQQEPASS  120
NFTTTTTTTT ATTQNSFDSS DDKSFLLQNN MSHQQFLNYQ SSSDHHVIQD SFKRESFFGH  180
DMVS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010692935.11e-106PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW31e-78LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0K9QFW01e-107A0A0K9QFW0_SPIOL; Uncharacterized protein
STRINGPOPTR_0010s19180.12e-90(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-78LBD family protein